PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01195.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 356aa    MW: 39168.1 Da    PI: 8.4854
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01195.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1208.7e-3863123262
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              ++++++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGg+++knk+ s
  Rsa1.0_01195.1_g00006.1  63 PHEKVNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSKKNKRPS 123
                              67899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2662114IPR003851Zinc finger, Dof-type
PfamPF027013.1E-3265121IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.42567121IPR003851Zinc finger, Dof-type
PROSITE patternPS01361069105IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009416Biological Processresponse to light stimulus
GO:0009845Biological Processseed germination
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MMHVKPMEQI MIPNNNTHQS NATPDARPNT ILTSNGVSAA GATVSGVSNN NNTAVVVERK  60
ARPHEKVNCP RCNSTNTKFC YYNNYSLTQP RYFCKGCRRY WTEGGSLRNV PVGGSSKKNK  120
RPSSSSSNIL QTTPSSLGLS TTLPDLNPPI LFSNQIPNKS KESSQDLNLL SFPVMQDQHH  180
HHHRGQMSQF LQMPKMEGNG NITHQQPSSL YGSSSSPVSA LELLRTGANV SSRSGINSFM  240
PSGPMLDSSN NMLYTSSGFP TMVDYKPSNL SFSTDHHQGM GHNTSRSDDH NDHHQGRILF  300
PFGDQMKELT SSITQEVDHD DNQQQKSHGD NNNNSSSPNT GYWSGMFTNT GEGSSW
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00319DAPTransfer from AT2G46590Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2324910.0AC232491.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB049N04, complete sequence.
GenBankAC2410330.0AC241033.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB045E05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013734873.10.0PREDICTED: dof zinc finger protein DOF2.5-like
SwissprotQ9ZPY00.0DOF25_ARATH; Dof zinc finger protein DOF2.5
TrEMBLA0A078E3060.0A0A078E306_BRANA; BnaC03g25870D protein
STRINGBra000429.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25282673
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46590.11e-176Dof family protein